DPCstruct | MC16919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 95 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IFN1 | 31-126 | DIISRMDFSDLNKTLYRCDQEERDETQGKFGVYNVPGYGPLVYAGLQGIVSLLADIRPNNDLGHPLCVNLRQGNWLIDYVWQRLKED… |
| A0A819MJA1 | 1-92 | QCNQIIQKLTLADLDRILYDGKGFYVYLILDYGKFFYCGNHEQISILDKIRLFNQLKHTFYNNLKQGNWLMEYIVNRLTILQNTKQV… |
| A0A820P4T9 | 66-163 | None |
| S9WDR6 | 561-652 | None |
| T1GKN8 | 453-533 | None |
| A0A0C2MJT8 | 7-103 | None |
| A0A3P8AVF1 | 871-969 | None |
| A0A818JHV1 | 115-217 | None |
| A0A0S7FT62 | 314-407 | None |
| A0A821XF01 | 10-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.