DPCstruct | MC16918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.62 |
| Pfam Score | 84.29 |
| Assigned Pfam label(s) | CL0229- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BG94 | 27-127 | EQEQLRARQISAQQINKVEELWKTNPDASLEDLEKPGVDDEPQPVVLKYEDAYQYQNVFAPLIKLEADYDKMMKESQSKDSVTVRWD… |
| A0A819LPM5 | 1-99 | TAQMINRLEELWEKNPDATIMDLDKPGIDEEPQQCCLRYEDAYQYQNIFGPLVKMEADDDKKLKESQTQENISVRWDMGLNKKRLAY… |
| A0A1J6JT71 | 68-167 | None |
| A0A287I1G8 | 142-254 | None |
| A0A0C2Z674 | 54-167 | None |
| A0A1W0X3S6 | 512-624 | None |
| A0A5K4EF93 | 112-207 | None |
| A0A1Y2C5X6 | 549-660 | None |
| A0A2H1C6K6 | 20-109 | None |
| A0A183E4F9 | 113-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.