DPCstruct | MC16917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 185 ± 35 aa |
| Standard deviation of domain lengths | 34.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7S563 | 1-132 | MSATAATGVFVLSLSAIPVTYVFNHLAAQHDFWTIVGVAALILLLVALLARILVKRKPPRDPLFYVYAVFGFTSVVNLIIGLEQDGV… |
| A0A819LKH3 | 42-234 | RIIIGIIGVSLLSIPICYILSYMKQMKNSLNVFLYSAIICISVAPLIYFLLIKHLLYIKKEIYFYIFTIFSFTAIADLLLALTIDNY… |
| A0A3Q3XKT3 | 3-190 | None |
| A0A6P9D3L1 | 3-187 | None |
| A0A3Q3LP15 | 1-158 | None |
| A0A5C6NME3 | 1-268 | None |
| A0A498MM10 | 240-438 | None |
| A0A1S3J6I5 | 3-190 | None |
| A0A3B3Q3Y3 | 6-165 | None |
| A0A2G8LM88 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.