DPCstruct | MC16914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 361 ± 28 aa |
| Standard deviation of domain lengths | 27.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5MGX0 | 104-492 | QVSLYLLSQVFLIIHYQPLVNALADVILNGDLTVFTTQTEQNTHKSSSNAGVRRFTKPPESLERSLEMSRHRGRKKTQKRPNYKNVG… |
| A0A4W6C2G2 | 306-655 | QVSLYLLSQVFLIIHYQPLVNALADVILNGDLSVFTPQTDIHNVKLSRVRRFTKPPESLERSLELSRHRGRKRTQKRPNYKNLGEEE… |
| A0A7J8IXU0 | 308-647 | None |
| A0A131YKR0 | 173-573 | None |
| A0A7F8QW13 | 1-361 | None |
| A0A814SQS5 | 1-333 | None |
| A0A2R5GU26 | 354-674 | None |
| A0A6P6CE81 | 126-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.