DPCstruct | MC16913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 2.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484MY99 | 344-404 | MEQLLQKAGEEILPGVRILCGGSYRRGKESCGDMDIVITHPDGKSHIGFLSKYVKHLKDMN |
| A0A819KG82 | 1-59 | MLYVREAAESIRPGLLIQTCGSYRRGKATCGDCDILITHRDGISHEHLLFPLVDKLKAN |
| A0A0A9E0C7 | 1-69 | None |
| A0A815W9J2 | 49-113 | None |
| K1PLM1 | 136-201 | None |
| B8JIE9 | 388-450 | None |
| A0A1D5PGM5 | 665-724 | None |
| A0A6I9PXT2 | 23-82 | None |
| A0A814NLT7 | 363-425 | None |
| A0A1I8IBB6 | 226-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.