DPCstruct | MC16908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 399 |
|---|---|
| Mean domain length (aa) | 217 ± 50 aa |
| Standard deviation of domain lengths | 50.43 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.58 |
| Pfam Score | 95.27 |
| Assigned Pfam label(s) | CL0023- PF21771- PF02872- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661CVC3 | 514-718 | NNFEVVGVAGMFFHGNEDIIRYQESALGNLVADVMLEAAKNEGAVAALTNTGILRTSIGEGEVTLAELLMTLPFGNTLVVLEVTGRE… |
| A0A6M1CMP0 | 5-152 | GSVDSKLEGDRSKVRFEQTSMGHLLLAAQKERANADFAIMSGGGVRDSIEPGDITYKNVLKVQPFANELVYVDFKGSEVLPYLTAVA… |
| A0A084RJU6 | 818-1032 | None |
| A0A7S0A0J9 | 96-308 | None |
| A0A1G6MXV9 | 305-556 | None |
| A0A1F6PPK3 | 96-315 | None |
| A0A248ZY21 | 2-148 | None |
| Q2PJ93 | 2-217 | None |
| A0A1G3YZM4 | 130-333 | None |
| A0A7S2K7M8 | 241-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.