DPCstruct | MC16906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2M6Y4 | 10-81 | RTGITTVTDFRVSDQAAGRQGAPLIAFFDALLLHHPTKLRACQNIGGIANVCFIPPDNKGGVSETYDFDTGP |
| A0A661CLE0 | 7-100 | PGITTVGDFRPADVAVGGNGSPCTCTYDYLMLRPKAGSLNRRICINIGGTSSVTFCPPEESVELPSGLEPGLGVTYIDGAANKCFLT… |
| A0A2V7S692 | 118-191 | None |
| A0A847VER8 | 48-112 | None |
| A0A149USK9 | 132-211 | None |
| A0A376S9G4 | 1-69 | None |
| A0A354VMU7 | 129-192 | None |
| A0A376F871 | 22-88 | None |
| A0A7H4MLD4 | 45-110 | None |
| A0A532CZD2 | 130-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.