DPCstruct | MC16904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661CKC4 | 2-84 | KQYRYVGPDDLRELISPDNCGTPIQRPQDILNWIKWINPKRQHHDEVIATFIINTDGFLCLADRHTEHLVCAGGCAVLSAGEM |
| A0A3N1CY76 | 152-242 | RRHRYVGPAEIGDRARAQPRGRAITSQVGLTGFLVREPDHEEPFTYVVDVTGALLLAPRRSEHVACAGGEPVLGAGEITFARTGVRS… |
| A0A117RT47 | 1-80 | None |
| A0A1H4IBL1 | 124-222 | None |
| A0A810NSR1 | 185-282 | None |
| A0A1S6JGT9 | 10-89 | None |
| A0A7W3LY56 | 1-80 | None |
| A0A3N4S770 | 189-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.