DPCstruct | MC16903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 218 ± 38 aa |
| Standard deviation of domain lengths | 37.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.27 |
| Pfam Score | 60.71 |
| Assigned Pfam label(s) | PF20269- PF11902- PF20270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A011NEG0 | 6-191 | NHPQRFALNYELHARPPEALSIPEQASYLALATDPANRQAEYESIVELCTRYGVTAPAPEVNHFKVDLGTFRLKWERRAECSSYTFF… |
| A0A661CH41 | 3-209 | KLIYLTLDLFLYDLREGLGQTEAEVTENRQNFQHKLLQTIDEQHFIQLDEHAFEPEYVELLGAQRHSDFESDIHEGYYYPVRLSDTY… |
| A0A7C6DPR9 | 9-189 | None |
| A8L3R6 | 108-352 | None |
| A0A1C0V6U4 | 10-252 | None |
| A0A6M0ADX0 | 1-229 | None |
| K0K976 | 3-223 | None |
| A0A1H1Y8E9 | 1-186 | None |
| A0A013VRS2 | 1-214 | None |
| A0A1Y5YAA2 | 17-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.