DPCstruct | MC16902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 218 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662SXV7 | 1-221 | MTTVYRDGDILLTRDKLIFTVLGYTHPPSRVIAALKYIPEELKHLFPGEYEGVRWRLAGTTMLRQVDALTPRGYLRSLSVLREHFPA… |
| A0A661CG84 | 1-223 | MRPLIRDNSFPYLPRDFIQTEQGLIFAVVSYQPQDEKVGCFLRYIFEGNIWKKVDTEKANTVLKQYYPQYCYQSKQFEASFHAVAVP… |
| A0A0U3DYF8 | 2-201 | None |
| A0A7V8VEV0 | 154-355 | None |
| A0A1Q6LG60 | 142-372 | None |
| A0A1F4V4V1 | 1-223 | None |
| A0A847FXK2 | 333-551 | None |
| A0A850MT86 | 144-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.