DPCstruct | MC1690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 17.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0V708 | 34-163 | QPGEHDLPPAGTDSVWVVAGRHYERGWLHRLFWGRHHRDSWTTPVKLPVFDLSRVNGGMEVIKKGGGYQTSSFHLQDSLGRTYAFRS… |
| A0A537KJU9 | 30-155 | NNTITTAANKQYNKAGKFKRMMFGEHYRKEWATPVDVEILDINVFAGGLNPVKMGGGLQTKSLRLESADGREYVLRSVNKDPSKAIV… |
| A0A1M4Y1E7 | 14-155 | None |
| S7VUT0 | 77-209 | None |
| A0A7C2P2V7 | 1-133 | None |
| A0A843T203 | 44-140 | None |
| A0A848XSI4 | 1-144 | None |
| A0A4D7JRN9 | 376-511 | None |
| A0A4Q5UZQ8 | 369-506 | None |
| A0A6C0RA30 | 129-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.