DPCstruct | MC169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 352 ± 29 aa |
| Standard deviation of domain lengths | 28.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2Z5U6 | 38-412 | ATYTFTATIRPEKDHKGQSMARVIEFGLGSSAEPGYCMNATREQGLWTDTTVQDNDLKFFPNQSGLEVYAQGIHPTNYSIAWTVKPV… |
| A0A2V5U265 | 114-469 | EVVVEPSGYTDSSAYEDWMPEGNLKDPNEPASPLLVKATLQTVAGGAPETKADWFTFELLNVSREPGACMNWPNKELADTNLDLRFD… |
| A0A3M1W2F2 | 1-337 | None |
| A0A7Y4VII8 | 478-833 | None |
| A0A846NNE1 | 24-426 | None |
| A0A3B0QTT8 | 167-506 | None |
| A0A3D2VCN4 | 411-766 | None |
| A0A2D6D2R1 | 14-348 | None |
| A0A7C3PI94 | 583-929 | None |
| A0A496B3Y5 | 49-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.