DPCstruct | MC16899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533V997 | 52-192 | SIDSRKFVSVSDGDKFLGDSDKVVGIKLNGDIRAYPLQILVWHEIVNDNVGRIPVAVTYCPLCFTNQVFNRTVNHTVLEFGTSGKLY… |
| A0A661CAG5 | 14-157 | FSGTIDKRLPAMERVLFVHHGTQQRLYPFALVSESGVINDALGKLKIAIFGKQGTLSALDAKQIKKSKQIVSVTAWSRQLDDQILSF… |
| A0A7W1K0H6 | 16-142 | None |
| A0A352KWP9 | 2-112 | None |
| K9Z663 | 191-336 | None |
| A0A6N7GDN0 | 120-252 | None |
| A0A2S6U740 | 72-180 | None |
| A0A6L8E4F3 | 318-468 | None |
| A0A0S7Z991 | 2-117 | None |
| A0A0B8PCV5 | 90-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.