DPCstruct | MC16898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8MYR1 | 77-159 | LAEPQKHELSRDGLITHMQVLGDGTQQLCVLDPRQRVVAVYHIDAAKGGIALRSVRSIYWDLRINHFNGTTPLPEEIRSLIEH |
| A0A3B8ZJ83 | 4-108 | AAWVTGAAGFFWLVSSTGTLLSQGTVLNQGGSGVAGLESAGLQMIATPLATGTQVVVLDPSQRCLAVYQVDAAGNVALKCVRNLAFD… |
| A0A7C1QNT3 | 43-123 | None |
| A0A7X7IKA2 | 43-128 | None |
| A0A517SQJ3 | 190-286 | None |
| A0A517NP86 | 119-227 | None |
| A0A3L7NQW9 | 2-93 | None |
| A0A3L7UAZ5 | 50-136 | None |
| A0A521KRX6 | 1-136 | None |
| E8QWJ4 | 54-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.