DPCstruct | MC16894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 2.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 74.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7LKQ5 | 2-58 | EHKQASLEELGALADPPLTKDAVAGRIRRLLAMADKRAQDLGIPGTEATLSEEMADG |
| A0A7W0JMG3 | 2-58 | RLEHGQASLEELGSLADPPMTKDAVAGRIRRLLALADKRAADLGIPDTESSVTAEML |
| A0A6N9VTK3 | 36-91 | None |
| X8FBW7 | 83-139 | None |
| A0A164C0R8 | 575-632 | None |
| A0A7K0XUX6 | 131-189 | None |
| A0A655DY48 | 12-68 | None |
| A0A7C6IH32 | 70-126 | None |
| A0A3G6JAW9 | 256-314 | None |
| A0A7X1I065 | 2-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.