DPCstruct | MC16893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559V9Q2 | 4-61 | GHCPHCGWADSTPFHTVSRHRTGGGMTIWTRCQCGSLQMRTVDAAGGRIVTRGRPAPD |
| A0A1E7LDF8 | 1-60 | MSDCPYCGWPDDEPVQGVSRHPTAEGVLAWTRCACGSLQARVLTAGTVRIVTRGKPADGR |
| A0A542TLI4 | 7-68 | None |
| A0A7G1N6N9 | 1-74 | None |
| A0A372M141 | 14-80 | None |
| A0A6N7IKF9 | 1-61 | None |
| A0A2T0LUJ3 | 18-78 | None |
| A0A2T0Q5L1 | 28-83 | None |
| A0A841NQ74 | 5-66 | None |
| A0A0M2GH19 | 6-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.