DPCstruct | MC16892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5W2I7 | 1-108 | MQDDAATVATLREQLAFAAEFRVPILDVGVGGYGEEVVKRAPGGTRWAVTDGAFSGLRAWGDGEGWRYITDIGRAATYRHNRDQALK… |
| A0A6G4U888 | 4-104 | LEVLRRQMALVVEFRVPVPDRGIGGYAEIVVRRERVDVDRWAVTDGAFTGLRAWVEGEGWQYVSDVGRAVAYAHGRDEALLLAHRVA… |
| A0A4S2SQ87 | 96-201 | None |
| A0A1Q5DH38 | 1-123 | None |
| A0A498DSM2 | 27-150 | None |
| A0A250VT03 | 60-191 | None |
| V9Z3J3 | 101-201 | None |
| A0A7X1LT08 | 2-135 | None |
| A0A7H8IZZ0 | 127-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.