DPCstruct | MC1689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 179 ± 30 aa |
| Standard deviation of domain lengths | 29.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838F792 | 7-194 | LELEVKNYVLVVDDLYGHYLDSTAGFSNNVRMIENAQNQIRSPGTDLDELIIYYTNASPNDPKNQMQHQTTQGNCKRRNATGGKNFL… |
| A0A509MVS8 | 7-198 | FEHTVDGLYGVYLDSLAGFRHLHAEGERKKANLAKLLCGDSASDTELAGAGAECVYSYAKGEPGEPDFVEIHTCTYDEYISRTAERG… |
| A0A4R1F9D9 | 3-212 | None |
| A0A6L7L398 | 7-156 | None |
| A0A6B1HE35 | 134-321 | None |
| A0A7D6E0Q5 | 123-322 | None |
| A0A3G8XH87 | 4-173 | None |
| A0A1R0U9L6 | 195-412 | None |
| A0A1T5HGL3 | 67-247 | None |
| A0A1P8XDL1 | 244-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.