DPCstruct | MC16887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7KVL4 | 19-83 | KRALAAFHLDPKKWGVNVQPLYDSPANFEVYTALLNPHDRIMGLDLPHGGHLSHGFMTPKRRVSG |
| A0A3Q0IS00 | 16-86 | IEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLVEPHGRIMGLDLFDGGHLTHGFYTPKKKISA |
| A0A482SR74 | 79-133 | None |
| A0A426Z6T6 | 33-85 | None |
| A0A396H6N6 | 42-112 | None |
| A0A4Y7JLF5 | 32-101 | None |
| A0A6J5VLQ7 | 150-214 | None |
| A0A0V0SJM7 | 124-184 | None |
| A0A3P7JC16 | 37-102 | None |
| A0A444XMT9 | 57-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.