DPCstruct | MC16886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Standard deviation of domain lengths | 21.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0EJR8 | 17-109 | QPSKNLMAERRRRKRLNDRLLMLRSIVPKISKMDRTSILGDTIDYMKELLEKVQNLREENTNAGMNQVNLMGNFKELKPNDVLVRNS… |
| A0A444YPA9 | 4-102 | KNLMAERWRRKMLNDRLYMLRSIVPKISKMDRTSILGDAIDYLRELLQWINDLHNELESTLPGSLLQSSTTSLQPLTPTLQTLPCQV… |
| A0A3L6RTN1 | 40-167 | None |
| A9SVD4 | 165-308 | None |
| A0A6A2YJ27 | 1-118 | None |
| A0A287Q0X7 | 1-128 | None |
| A0A7I8IF48 | 24-100 | None |
| A0A803MUX3 | 1-84 | None |
| A0A2G2Z1V3 | 44-179 | None |
| A0A2Z7A9N2 | 34-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.