DPCstruct | MC16883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 105 ± 24 aa |
| Standard deviation of domain lengths | 24.44 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453I8Z1 | 2-86 | QVYRCCEGALRLDPSGVIGVPLGAVDYYCGGECVVETEDVLNCVASALDGFSFHNGASVEGARYALRRGCSHTIKRGDFNALEPP |
| A0A2G5EZS7 | 9-96 | LISLTAQEKGSLQIYKSCDESCRLTQSGNINVSPEETDQFCEGPCFEESNHVLNCLNDVFSHFLFYNEATIKDVRATLRAGCSHTSER |
| A0A6G1EME8 | 183-321 | None |
| U5D2W4 | 28-147 | None |
| A0A5S9YEQ4 | 237-346 | None |
| A0A444WPP8 | 68-144 | None |
| A0A5N6PVX2 | 38-185 | None |
| A0A843UFZ3 | 57-174 | None |
| A0A811NW46 | 10-87 | None |
| A0A4S8J572 | 5-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.