DPCstruct | MC16882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1862 |
|---|---|
| Mean domain length (aa) | 108 ± 26 aa |
| Standard deviation of domain lengths | 25.62 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | PF02825- PF20979- PF18212- PF15842- PF00787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A152A3G4 | 22-107 | QFILKHRPTPPISEYHFKEMTEEIEVTKKNKERLGDCSICTVDFPLEDYVIKLPCKHYFHFDCITKWLGMHSVCPNCRFELPTEDS |
| A0A2G5EYV8 | 15-111 | EFVHTVLCDVQAFNESFMDEEVDPILVPAAPSYVEALKTKQYDKENSKEESCSVCYQEFLMAEDVTLMPCSHIFHNNCIGRWLEMTN… |
| A0A061R066 | 48-191 | None |
| A0A1V8SU11 | 421-544 | None |
| A0A4Y7KSA3 | 156-253 | None |
| A0A7S4PGU4 | 146-266 | None |
| A0A7W1MB02 | 1-79 | None |
| A0A3N4I9K1 | 415-494 | None |
| A0A3N4IMD6 | 95-205 | None |
| A0A6U0VJD2 | 66-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.