DPCstruct | MC16881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537KFR4 | 59-122 | NLDANGVIIDGYDPVAFFTDNKPVKGDPTLQYKYQDATYYFASKEHLDLFKADPEKYKPQFGGW |
| A0A346R5J3 | 54-135 | QSAPEPATRLPTNSRDILVDPMTGLALLGYDPVAYFVDRKPRRGERRYELFWSGVVWRFVNEGNMAAFEAAPEVYAPQFGGY |
| A0A6J4XUF0 | 78-145 | None |
| A0A7C5BX51 | 18-89 | None |
| A0A6C0HBZ6 | 27-110 | None |
| A0A2A4Z566 | 19-102 | None |
| A0A5B9PDB3 | 32-104 | None |
| A0A257WMM4 | 2-72 | None |
| A0A2G4IXE1 | 334-413 | None |
| A0A1E5T337 | 5-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.