DPCstruct | MC1688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P09881 | 2-85 | ELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG |
| A0A509MPH3 | 5-93 | RIEDITREELVAFLKRIFDVTDCAETHDELIDQFEDLSQHPDGSDLIFYPENPDDSTPERIVEIVEEWRARNGLPGFVTAMLVVAGL… |
| A0A2T6GAR7 | 142-222 | None |
| A0A7Y1CV59 | 25-113 | None |
| A0A7X1W190 | 1-102 | None |
| A0A2R7SY98 | 2-87 | None |
| A0A5F1H3N7 | 6-98 | None |
| A0A5C1NHX3 | 36-133 | None |
| A0A1G9FKW1 | 3-85 | None |
| A0A5E7D3Q6 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.