DPCstruct | MC16877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3JNG5 | 658-830 | VSSVRDENTLTVNIGERKGNYQGMPKKRNYSIDILGSAPAVRVTVNGKEAAYSYDGTELKLSISLPDSNCKRAYTVKVTYDSNQPEI… |
| A0A021VSG9 | 1-144 | MPDRRRWTVTFVAAPDDLAADDGALAVTVDGAEVPATVERRHATPQPDGPGARPTTRVSITVDDVPTTATLAVSVGAAPQVRPNDVD… |
| A0A7X7ASW4 | 260-405 | None |
| A0A3B9JKI9 | 13-153 | None |
| A0A1Q6LHF1 | 291-430 | None |
| R7M3Q9 | 638-784 | None |
| B6XW70 | 24-181 | None |
| W2VGJ3 | 152-309 | None |
| A0A7X7HA68 | 296-438 | None |
| I8IFR1 | 846-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.