DPCstruct | MC16875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9KYN1 | 28-137 | YRIKVLNTINFKKSMKYNPFAYIHSEKDILKLVTTLIANTKGEGKAGDDFWVKAETLLYCALIGYIHYEAPVEEQNFSTLIEFINAM… |
| A0A135YMQ6 | 1-119 | MLEDNGYEIKILNTINFKKTMEYNPFAYIRFEKDILKLVQTIIANTKGEGEKAGEDFWVKAEKLYYTALIGYIWYEAPREEKNFATL… |
| A0A6I2R9P0 | 140-255 | None |
| A0A4S2H001 | 1-117 | None |
| A0A174NUA2 | 60-187 | None |
| A0A0M6WU47 | 1-99 | None |
| A0A417BRY3 | 187-301 | None |
| A0A1C5WHY7 | 85-194 | None |
| A0A415ZK87 | 242-380 | None |
| R9KJ01 | 264-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.