DPCstruct | MC16874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 17.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077KLX9 | 1-72 | MKCPSCKTEVSGDYELPVLLKLNRDEQDFILNFFLSSGSIKEMAKQAGLSYPTMRNKMDDLITKVEQLKNNL |
| A0A2N2NIV2 | 52-164 | MNKLPTQCPMCRNDLEVTGLYCPHCDTSIQGHFAPTANPFNVLNQEQMHFLMTFIRCEGRFNRMEEELSLSYPTLRNRLQDILRLLG… |
| A0A166VVE8 | 9-138 | None |
| A0A6J4HWI2 | 1-113 | None |
| A0A421CM45 | 1-98 | None |
| A0A1V4VNF6 | 4-100 | None |
| A0A0C1J6B3 | 2-82 | None |
| A0A8B4QRR0 | 46-131 | None |
| A0A2A5WWW7 | 9-109 | None |
| A0A4Q3UBL4 | 6-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.