DPCstruct | MC16871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12543 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9L6L5 | 103-202 | APEFEVATIKPTDPSWTSRGFHAGGRRISCDTETVDDIISFAYGVHVRQIVEGPGWLGTDKYDVDGVPDLIGEPNLRQMQAMYRGLL… |
| A0A4Q0T3X4 | 1-153 | MARRAAVLLSLCIGSSLLSAQTVQPGAQPALQFEVASIRPHQSTGNDPSNRKVLPGGRFVATATTVRTLIRIAFGTDDNRMSGAPKW… |
| Q02CM9 | 7-138 | None |
| Q022I5 | 13-115 | None |
| Q01YQ7 | 1-125 | None |
| A0A2N9N564 | 17-120 | None |
| A0A2N9N1M3 | 1-145 | None |
| A0A2N9MY16 | 19-151 | None |
| A0A2N9MUA4 | 2-124 | None |
| A0A2N9MRZ6 | 113-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.