DPCstruct | MC16870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Standard deviation of domain lengths | 15.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 51.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0T3H4 | 19-104 | PQLSESTRHYTKITPTKLAKSYQDAGYFARNLRAVEVLIDRDAVRRGSSPDEPWKLYDLGHGYCSYDFFDQGLHRMACARCDFYVP |
| A0A1B1LQR4 | 49-161 | ELMEWSGHSCPRSTLHYIRIRPTRLAASFVKADKISHMISVLIDHDSQALTSSGPALYYDLGDLYCTNPFWSSCPHRMACIGCDFSL… |
| A0A3M5G7T4 | 1-115 | None |
| A0A2V9HHR7 | 13-97 | None |
| A0A1G9S320 | 46-129 | None |
| A0A840QAP7 | 194-312 | None |
| Q0RGW5 | 154-272 | None |
| A0A535F9V7 | 467-579 | None |
| A0A5M3W1N4 | 40-121 | None |
| A0A1S2PMF3 | 6-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.