DPCstruct | MC16867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7ASB1 | 147-264 | TAEASGRVLATRLYNLTEDKGMKDFLSFLIARDTMHQQQWLAVLEEMGGLSASLPIPNSFPQENEASEHSYYCLNTSLDKPLPKGRW… |
| A0A4Q0SXZ3 | 10-110 | MLAFNIARDTMPQQQWLAVLEELGPSALPIPNSFPQSKENQDYSYKFFITTTDGIGNQANQPWTSGPTPDGLGQFEPFIAGPLEGAE… |
| A0A1I1VHC7 | 59-171 | None |
| A0A2N5MNB0 | 71-173 | None |
| X5X5K7 | 1-114 | None |
| A0A1E4PCT5 | 38-135 | None |
| A0A6D1GKG0 | 81-211 | None |
| A0A838UTZ8 | 156-280 | None |
| A0A4E0Q0V2 | 56-168 | None |
| A0A1I4A6P7 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.