DPCstruct | MC16864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 165 ± 22 aa |
| Standard deviation of domain lengths | 21.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6QII0 | 2-107 | LTRRIFSHAGEPWEGNNVPLQADIVLITKLWNEYSTGPCPISFSSAEADSIIHLQSMQEEVDLQLKLVRDFIGVGVDGWTSPDAYEA… |
| A0A7H8RDT0 | 5-177 | PDDYETLSDEGRLRADKLYDSALCHKYYEVLTAKRNPQHYAAITHNDTWKAPLIQPIKSIGGAWSSGEVFGLRSSLMNVQDHWPELE… |
| A0A370TNQ9 | 1-129 | None |
| A0A1L9VDT9 | 1-159 | None |
| A0A1L9V5C8 | 1-240 | None |
| A0A1L9WMR3 | 71-236 | None |
| A0A317A3W7 | 1-125 | None |
| A0A229XXG8 | 717-892 | None |
| A0A146FXM4 | 97-238 | None |
| A0A0A2HZF4 | 192-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.