DPCstruct | MC16861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9QLU0 | 14-126 | KEPRVGIFWVLNGEPLIDSALLSDAEPYGDHLTHPRGHPEVWEQWQRTRAVSPDMEYEESPRGRVMYNTKTRRFTLLADKCILREKN… |
| A0A257KMF6 | 24-135 | TPEVGIWWIIDGELIADSIPYTETPEEVGFRAGRNDHFQFFATLQKLVPELRDAEYIDAPRGRVIYDVAQQQFLCYGSKQSASSPAQ… |
| A0A501X4L5 | 5-116 | None |
| A0A7C5LKI4 | 2-125 | None |
| A0A1I4EJR4 | 1-111 | None |
| A0A7C6Y8C3 | 82-184 | None |
| A0A1V5X963 | 10-97 | None |
| A0A2D5T5J6 | 2-93 | None |
| A0A1N6JTP7 | 375-497 | None |
| A0A3A9BPV0 | 3-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.