DPCstruct | MC1686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 183 ± 27 aa |
| Standard deviation of domain lengths | 27.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | CL0023- CL0259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A539E4Y0 | 2-111 | LRHAVRINSLTELALTKLDVLDTFDTVKVCVGYSVDGRMLPHFPDRIELLAQVEPQYVSLPGWGRQLRSIRQVSELPAPAKAFVDLV… |
| A0A1F6AHE0 | 266-461 | LGTLPDITASDTSSYGIHTGTAFWKVEDIEKRIGIFKIPYTSSVGVRRMPTHADDAWSKRVREKAHEYGTTTGRPRDILFLDIPMLS… |
| A0A7Y4QDL2 | 34-233 | None |
| A0A2H0SPV5 | 29-228 | None |
| A0A2K6SN73 | 198-394 | None |
| A0A0J9V3A4 | 70-246 | None |
| R1CKT9 | 4-133 | None |
| A0A358XRE8 | 6-151 | None |
| A0A2A2K597 | 148-319 | None |
| A0A816QG99 | 135-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.