DPCstruct | MC16858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4D3A6 | 1-85 | MANPFSGIPTEHTFESGGVRYYANCAWDALGIPAALRRGGTVGSRCAHSAEPLRLPVTEVGPEPSDWLFHSRVPAAHWWDDIVFT |
| A0A3C0HDH7 | 64-149 | HPFSLAPTNFYIKSDKGEWWGNCAWCSLGVAALLKTNLTISTTIGAEGRPVTITIADGKIKEQNLYIHFPIPMKNAWDNVIYTCST |
| A0A2V6SSE0 | 86-169 | None |
| A0A537FUX4 | 35-123 | None |
| A0A7X9KKY3 | 1-80 | None |
| A0A7C1GYC9 | 193-270 | None |
| A0A0F6A8H6 | 51-135 | None |
| A0A815NMN9 | 231-316 | None |
| A0A7J9XBJ9 | 269-350 | None |
| A0A7V9SGS7 | 62-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.