DPCstruct | MC16855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00994- PF03453 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3AKG5 | 199-274 | LTAGSVLSPADIALAAVSGVDKVPVVPVPDARLLLTGSEVQSSGVPTPGFVRDAFAPTVPPVLTSLGARVDSVRRL |
| A0A7J0CTM9 | 1-94 | MVPAGTVVTPAVLGLAAAAGYDALPAVPRPRVDVLVLGDELLAAGLPHDGLIRDALGPMLGPWLRALGAEVSGPAASGTTRRPCVRP… |
| A0A6P8HAL4 | 60-143 | None |
| A0A5B7UW91 | 402-475 | None |
| A0A0S1UEA2 | 162-237 | None |
| A0A6V8PPN8 | 3-80 | None |
| A0A1R1LBH9 | 148-223 | None |
| W4S581 | 44-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.