DPCstruct | MC16852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8FMZ4 | 14-102 | VDLNRRKAIRERCLNCSGWVRSDVTHCDIPHCHLYPYRMGAGPQNAKEREKAIRRYCLECMGGQRAEIAKCTCPDCSLYPYRMSQVD… |
| A0A194AGS4 | 7-117 | SPIKAIRKTCLLCQGGSRKFVAECPDRTCPLYPYRFGTRPQGTRANLLKVIRKYCLRCAGSARGADACTASTHVGNMDPCWLHPYRK… |
| A0A2N2IB46 | 54-143 | None |
| A0A1B7XAE6 | 2-90 | None |
| A0A1X7C3C7 | 47-141 | None |
| A0LG16 | 8-95 | None |
| A0A7Y3TZH1 | 1-101 | None |
| G1UXH4 | 2-113 | None |
| A0A1V4XVW8 | 1-108 | None |
| A0A0X8JPX3 | 41-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.