DPCstruct | MC16850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5JR92 | 9-136 | GSHVVRNNVIFDCEQTGICGHMGAIFSVIENNHIYDIHTKRQFTGAEIGCIKLHAPIDVVVKDNWLDNGYRGIWLDWQCIGTRITGN… |
| A0A2M7L034 | 1-123 | MAHNLVHHAPHSAVFYSGNDLVMEYNDLYWCHYETAEGGVFYTGYDWTYRGDLIRNNYIHHLHDSLDGSPTGVNVVHLDDCVSGTDF… |
| A0A7X6ZFN1 | 40-167 | None |
| A0A7X6YFG6 | 124-274 | None |
| A0A7V7D7U5 | 461-581 | None |
| A0A0S4JSG9 | 44-156 | None |
| A0A3D4ZXE8 | 16-141 | None |
| A0A847JUP0 | 16-153 | None |
| A0A0A1U985 | 1-138 | None |
| A0A7W1UI96 | 231-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.