DPCstruct | MC1685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 263 ± 40 aa |
| Standard deviation of domain lengths | 39.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7CJW0 | 22-305 | DDEDPISRISEAPIVARVGALAVLHAVGDRAGLIYPIEFHNSTIAPSNTFSEQLFVDAWHFNLLHVHPTSPTDAFVWDDGTTLGTTL… |
| A0A1K0INA5 | 139-387 | VERRIEPADISLRSAVALLALFRCANAEPGADDLPPFKASTIPFAPVVSCRRILFDLLETGLVTVHPKTSIGAFAFKDGELTGWRFD… |
| A0A7Z6TAD7 | 2-204 | None |
| A0A5C9CN64 | 38-333 | None |
| A0A3A9ZQJ2 | 6-247 | None |
| H1LHC7 | 13-225 | None |
| A0A3Q8RSP2 | 21-258 | None |
| A0A2T0QJK6 | 629-878 | None |
| A0A5E4VPN7 | 2-204 | None |
| A0A1G7NYP8 | 61-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.