DPCstruct | MC16845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 140 ± 20 aa |
| Standard deviation of domain lengths | 19.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402EBT4 | 11-161 | EWLKQLWTETKIDVVLALTCGSAAAFLALKWARQKRIKTQIQDAREKRELGLEKMGKAVQKFKQQNPSVQAAHILSLPLVEMAEKLR… |
| A0A668T265 | 4-142 | WTAALLTGVACFGGYLIVLVKKINSHRKAEEKIKRARNRRDESLQRAEQAVLWYKESHPTTDSALILTLSLSELTQQLNKGLLSPED… |
| A0A6J3FCG4 | 2-107 | None |
| A0A0B1TTX8 | 33-187 | None |
| A0A3Q1GW66 | 4-163 | None |
| A0A158R2W9 | 2-140 | None |
| A0A368FJR9 | 22-165 | None |
| A0A0R3QS96 | 22-155 | None |
| A0A3Q0RZA6 | 6-145 | None |
| A0A2A6C240 | 239-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.