DPCstruct | MC16843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 158 ± 24 aa |
| Standard deviation of domain lengths | 23.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2MYH9 | 2-167 | ILIILGIAVIALYLSFIMMKSSVVRSILVTIFGAITIVSLLLINMNDVQHYGMKKETVETTKTIYSASPNAQLPMLLKQDVGTSGKH… |
| L0ILS6 | 7-163 | ALAIYLACLILHSLFRNEKYKNVAGVVCAITLLISLASLTTSMFLSFFLPFKYETKVVRIKPIYSVEDVNSINGRFVIGTGSVDQDI… |
| A0A0R2BXX2 | 8-175 | None |
| A0A0R1X0U9 | 2-172 | None |
| C7XVM1 | 1-111 | None |
| A0A2Z6T8Z8 | 1-209 | None |
| A0A1V9RC17 | 19-193 | None |
| A0A091BXM5 | 1-114 | None |
| A0A0R1R3W4 | 18-188 | None |
| A0A2N9K838 | 7-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.