DPCstruct | MC16840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Standard deviation of domain lengths | 21.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430PZM4 | 35-201 | EDHKGHEKMHLEMFLVAFVSLLFCQLVLMFWKKRHFRSYQLVTLIAMWLVPFIYSVIAEFPRFIFVWVLFSLTTGVMVYLASKRRIS… |
| A0A0R3X9E6 | 12-178 | IHEEHKGHETMHLEMFLILVFFTFGAQFALMAWKQYRPKSYHLLTLLGMWIVPMCYSSYMLYLRFMTVWFFFSLVTAVMVYLSSCSC… |
| A0A2R7WAC8 | 2-126 | None |
| A0A6J8DDK1 | 31-210 | None |
| A0A4W3GX87 | 59-231 | None |
| A0A7R9TMR7 | 72-240 | None |
| A0A7J7F5V8 | 108-281 | None |
| A0A7E4SDM6 | 10-181 | None |
| A0A061R4V6 | 111-278 | None |
| A0A2H9TI08 | 14-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.