DPCstruct | MC1684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7M659 | 91-214 | AREVQHNLEGIVANENVDTVPREVWYTVRQKLTDHKMTHRAFAEAMRTPFCGSTMWKHAPSRSRLHRAAAILDDRSLHDLTKNDLLW… |
| A0A6N7CJW9 | 1-125 | MARGVLAELLSLAPNVNVDTIPLEIWFRVREILASNGVSHRAFAAAMNIKFCGSTLWKHGVSRSRLVKVAEFLDDDGLRVLATSDVF… |
| A0A100X2Z8 | 198-321 | None |
| A0A654TBT4 | 186-297 | None |
| A0A7W1GN59 | 115-239 | None |
| A0A534CVT8 | 157-274 | None |
| Q3F188 | 30-144 | None |
| A0A1G2EST7 | 46-171 | None |
| A0A2V7VDH9 | 219-339 | None |
| A0A7V9JYX3 | 274-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.