DPCstruct | MC16839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 222 ± 31 aa |
| Standard deviation of domain lengths | 31.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0023- PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348B3T6 | 1-188 | MDDSRLQELATQMRFRLEEGGGEAFYILGVADSGDVVGISDDELRDTVEVLSRAAELVRARIAYTRVAEVRKGGKIAEVLVRLSRES… |
| A0A0R3X981 | 39-273 | HQLSDDVSIGRNKSEPSFSTRISNAFLQSNSFTGTSSLPLNLPPEPEDGNIEYKWRLNEGGGQAIYRLGVDDNGAVTGLTAKEMSAS… |
| A0A433DKM0 | 28-297 | None |
| A0A7S3GA31 | 5-241 | None |
| A0A7S3G827 | 32-243 | None |
| A0A1Y2HQP3 | 22-262 | None |
| A0A7R9L3Z0 | 11-256 | None |
| A0A7R9UBW3 | 18-270 | None |
| A0A0V0QLS1 | 133-355 | None |
| A0A3Q0JHC9 | 63-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.