DPCstruct | MC16837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 198 ± 34 aa |
| Standard deviation of domain lengths | 33.70 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05346 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0JBY8 | 2-162 | PMRIAMTIWRLLKTRKFKRPSTIELSDFGCFLIMACGVIVLQQIDISLIYHMIRGQATIKLYVIYNMLEIFDKLCQNFIGDVLPMLF… |
| A0A0R3X5Y4 | 141-366 | LSIPQYFESFMFYGLLQCLDHILMVYTFLPLRCIIIFISLLSYVTFSLVGSCIPSFKPKNFILYATDVRELVKFSFVCICTIFLYTF… |
| A0A4V1XEX9 | 391-542 | None |
| A0A0E9NCF7 | 179-407 | None |
| A0A7R9TIS5 | 69-219 | None |
| A0A3P6NNU2 | 2-149 | None |
| A0A0M8N8C3 | 1-140 | None |
| A0A1Y2HLX6 | 313-527 | None |
| A0A811MSC5 | 244-413 | None |
| A0A7S0A0T7 | 53-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.