DPCstruct | MC16836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 50.60 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF02580- PF05817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3WYK9 | 9-67 | FPLSLSAPLFHLGMGGIFGLYLLYWFKLDMFTTLRYLLFLGIFTFVAGNRLLRHIVTEQ |
| A0A0N4X9J8 | 48-106 | MPLNVWTVTFHGSLAALFALYFVFWLQLNMFETLKYLAVVGGLTYIAGNRVLRAIARKR |
| A0A3P7J5B3 | 78-142 | None |
| G3WXP9 | 798-866 | None |
| A0A0V0WGR5 | 586-655 | None |
| A0A0N4XSW5 | 1-59 | None |
| A0A3P7H4G2 | 57-125 | None |
| A0A4S2KXB8 | 482-551 | None |
| A0A183BVB7 | 13-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.