DPCstruct | MC16834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 166 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8LF64 | 71-224 | ENLGGSAGGMKFVWRGILFKLADGSRGPYLGNDEAAAKGAGHDLRGATHYLDARIRGLRYALQCLIDYKGFRMTAQAVLPVSSETLR… |
| L8GEL6 | 392-547 | GEKYIVQGIFFKFALDIFGIYGGDEYAMKAASHDLKGLIHYYSCQIPGLHVPLMALIDYLGFRLIAITILPINNTTIQYGSCDAGQT… |
| A0A0S7F2W8 | 340-515 | None |
| D7G5G9 | 306-460 | None |
| A0A183J3F1 | 178-357 | None |
| A0A6H5KFE7 | 1-175 | None |
| A0A6V7YBR4 | 463-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.