DPCstruct | MC16833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 243 ± 24 aa |
| Standard deviation of domain lengths | 24.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9IDH7 | 102-356 | ELWVEIQELNEQGEYSPVDVVVKQDTWTGGIYQLRQGQQRRIQVRVKPVQNSGTLPIICQSILNIAVGSVSVRNRLQIPLDSYQDED… |
| A0A0R3WTJ7 | 1-214 | GSFKKVPVIPSSDVKTGGIYQLRQGLNRRIRVLIRPNELSRRERGVLPLFCETVSKEYDLETVRHKWCNAMDEWQSYLQSNLQALAK… |
| A0A1S3SBF3 | 13-247 | None |
| F1KQE1 | 256-535 | None |
| A0A6H5HKJ0 | 499-742 | None |
| A0A0M3IPH9 | 139-430 | None |
| A0A212C5G9 | 545-779 | None |
| A0A819S5V8 | 1-202 | None |
| S4RE50 | 371-627 | None |
| A0A834PU01 | 653-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.