DPCstruct | MC1683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7CBW5 | 1-154 | MTVPVAYTAGERIVGIPATVEYPGLLRIEYRLETKRSPTGDAATAVIRLASELELPTAPPFVVVFNAGRLPLSARDGEPLEVRGDGQ… |
| A0A378V0S4 | 92-245 | SLHLAPVAFSGGRRVTGPVASIEYAGMLRLQYAVRIGRDPGGFPTTATVAVRSEYDIPGSPSFVLVNNPQRMPLSVHDGQPVDVAPL… |
| A0A1C5GB93 | 364-501 | None |
| A0A495ADA1 | 746-874 | None |
| A0A419F9Y8 | 573-707 | None |
| A0A263BRU5 | 898-1036 | None |
| A0A4P7SQK8 | 1-173 | None |
| A0A2Z5QWG7 | 232-410 | None |
| A0A255EG15 | 766-913 | None |
| A0A7J9XY02 | 507-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.