DPCstruct | MC16829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EI69 | 220-330 | RTMINAADFVLYAVDCRRGRSDWDDIRRELTELALALTPCQTLVVLGLCGVFDNNRNELVSAVEIVQNLGGVDDGPLAVAKTNWRVW… |
| A0A0R3WPU2 | 13-129 | RKELRLSDCVLYGQSLSVLLQRQDNARRELGASLRLLTPQHTLAIVIVDDVEGRERSGMDLFVEYAKKLGFGTEAPLTTAPMNWRIW… |
| A0A068YDY8 | 82-189 | None |
| A0A0R3WH25 | 62-166 | None |
| U6I1W3 | 118-239 | None |
| U6HL25 | 6-125 | None |
| A0A654GSN3 | 255-379 | None |
| W6UQ71 | 51-149 | None |
| A0A0R3WE51 | 2-113 | None |
| A0A158QGU4 | 324-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.