DPCstruct | MC16827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225VML7 | 3-122 | QDARNDMRNLVAFWVLGFINNIGYVIMIAGAQEIAEGGVGLVYFFDIFPALFVKLSGPYWFQLVSYRQRTIMGAIWMLLSFLVVAKG… |
| A0A0R3WMU5 | 2-155 | VSARVQDSYQAWRNYVAFWCFGLFNNFNYVVMLSSAVDILGRGTAKGSDRDADWQDYFNCTGVGTGTVLLADIGPSLLLKLLAPFFI… |
| A0A0B1T089 | 62-196 | None |
| A0A6H5IPV4 | 31-179 | None |
| A0A1I7WJ38 | 2-136 | None |
| A0A819DCR0 | 295-419 | None |
| A0A7S2SKA9 | 28-158 | None |
| A0A821B3S1 | 170-298 | None |
| A0A1J1I4F5 | 817-963 | None |
| A0A821XJQ3 | 272-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.